Lineage for d2vomb_ (2vom B:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2413227Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2413228Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (2 families) (S)
  5. 2413229Family c.1.1.1: Triosephosphate isomerase (TIM) [51352] (2 protein domains)
    automatically mapped to Pfam PF00121
  6. 2413230Protein Triosephosphate isomerase [51353] (20 species)
  7. 2413294Species Human (Homo sapiens) [TaxId:9606] [51355] (8 PDB entries)
  8. 2413302Domain d2vomb_: 2vom B: [168754]
    automated match to d1htia_
    mutant

Details for d2vomb_

PDB Entry: 2vom (more details), 1.85 Å

PDB Description: structural basis of human triosephosphate isomerase deficiency. mutation e104d and correlation to solvent perturbation.
PDB Compounds: (B:) triosephosphate isomerase

SCOPe Domain Sequences for d2vomb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vomb_ c.1.1.1 (B:) Triosephosphate isomerase {Human (Homo sapiens) [TaxId: 9606]}
srkffvggnwkmngrkqslgeligtlnaakvpadtevvcapptayidfarqkldpkiava
aqncykvtngaftgeispgmikdcgatwvvlghserrhvfgdsdeligqkvahalaeglg
viacigekldereagitekvvfeqtkviadnvkdwskvvlayepvwaigtgktatpqqaq
evheklrgwlksnvsdavaqstriiyggsvtgatckelasqpdvdgflvggaslkpefvd
iinakq

SCOPe Domain Coordinates for d2vomb_:

Click to download the PDB-style file with coordinates for d2vomb_.
(The format of our PDB-style files is described here.)

Timeline for d2vomb_: