Class b: All beta proteins [48724] (174 folds) |
Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) |
Family b.29.1.22: SPRY domain [141154] (6 proteins) Pfam PF00622 |
Protein automated matches [190921] (1 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [188414] (2 PDB entries) |
Domain d2voka_: 2vok A: [168750] automated match to d2iwgb1 |
PDB Entry: 2vok (more details), 1.3 Å
SCOPe Domain Sequences for d2voka_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2voka_ b.29.1.22 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} ahhhhhhmvhitldrntanswliiskdrrqvrmgdthqnvsdnkerfsnypmvlgaqrfs sgkmywevdvtqkeawdlgvcrdsvqrkgqfslspengfwtiwlwqdsyeagtspqttlh iqvppcqigifvdyeagvvsfynitdhgsliytfsecvfagplrpffnvgfnysggnaap lklcpl
Timeline for d2voka_: