![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
![]() | Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) ![]() |
![]() | Family b.29.1.22: SPRY domain [141154] (6 proteins) Pfam PF00622 |
![]() | Protein automated matches [190921] (2 species) not a true protein |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [188414] (3 PDB entries) |
![]() | Domain d2voka1: 2vok A:14-192 [168750] Other proteins in same PDB: d2voka2, d2vokb2 automated match to d2iwgb1 |
PDB Entry: 2vok (more details), 1.3 Å
SCOPe Domain Sequences for d2voka1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2voka1 b.29.1.22 (A:14-192) automated matches {Mouse (Mus musculus) [TaxId: 10090]} mvhitldrntanswliiskdrrqvrmgdthqnvsdnkerfsnypmvlgaqrfssgkmywe vdvtqkeawdlgvcrdsvqrkgqfslspengfwtiwlwqdsyeagtspqttlhiqvppcq igifvdyeagvvsfynitdhgsliytfsecvfagplrpffnvgfnysggnaaplklcpl
Timeline for d2voka1: