Lineage for d2voka1 (2vok A:14-192)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778274Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2778275Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. 2780523Family b.29.1.22: SPRY domain [141154] (6 proteins)
    Pfam PF00622
  6. 2780548Protein automated matches [190921] (2 species)
    not a true protein
  7. 2780551Species Mouse (Mus musculus) [TaxId:10090] [188414] (3 PDB entries)
  8. 2780552Domain d2voka1: 2vok A:14-192 [168750]
    Other proteins in same PDB: d2voka2, d2vokb2
    automated match to d2iwgb1

Details for d2voka1

PDB Entry: 2vok (more details), 1.3 Å

PDB Description: murine trim21
PDB Compounds: (A:) 52 kda ro protein

SCOPe Domain Sequences for d2voka1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2voka1 b.29.1.22 (A:14-192) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
mvhitldrntanswliiskdrrqvrmgdthqnvsdnkerfsnypmvlgaqrfssgkmywe
vdvtqkeawdlgvcrdsvqrkgqfslspengfwtiwlwqdsyeagtspqttlhiqvppcq
igifvdyeagvvsfynitdhgsliytfsecvfagplrpffnvgfnysggnaaplklcpl

SCOPe Domain Coordinates for d2voka1:

Click to download the PDB-style file with coordinates for d2voka1.
(The format of our PDB-style files is described here.)

Timeline for d2voka1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2voka2