SCOPe 2.01: Domain d2vocb_: 2voc B:

Lineage for d2vocb_ (2voc B:)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (35 species)
   not a true protein

7. Species Bacillus subtilis [TaxId:1423] [188752] (2 PDB entries)

8. Domain d2vocb_: 2voc B: [168749]
   automated match to d1f6mc_
   complexed with peg; mutant

Details for d2vocb_

PDB Entry: 2voc, 1.5 Å

PDB Description: thioredoxin a active site mutants form mixed disulfide dimers that resemble enzyme-substrate reaction intermediate

PDB Compounds: (B:) thioredoxin

SCOPe Domain Sequences for d2vocb_:

Sequence; same for both SEQRES and ATOM records:

>d2vocb_ c.47.1.0 (B:) automated matches {Bacillus subtilis [TaxId: 1423]}
aivkatdqsfsaetsegvvladfwapwcgpskmiapvleeldqemgdklkivkidvdenq
etagkygvmsiptllvlkdgevvetsvgfkpkealqelvnkhll

Timeline for d2vocb_:

• d2vocb_ is new in SCOPe 2.01-stable
  
• d2vocb_ appears in SCOPe 2.02
  
• d2vocb_ appears in the current release, SCOPe 2.08, called d2vocb1