Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.0: automated matches [191312] (1 protein) not a true family |
Protein automated matches [190056] (35 species) not a true protein |
Species Bacillus subtilis [TaxId:1423] [188752] (2 PDB entries) |
Domain d2vocb_: 2voc B: [168749] automated match to d1f6mc_ complexed with peg; mutant |
PDB Entry: 2voc (more details), 1.5 Å
SCOPe Domain Sequences for d2vocb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vocb_ c.47.1.0 (B:) automated matches {Bacillus subtilis [TaxId: 1423]} aivkatdqsfsaetsegvvladfwapwcgpskmiapvleeldqemgdklkivkidvdenq etagkygvmsiptllvlkdgevvetsvgfkpkealqelvnkhll
Timeline for d2vocb_: