Lineage for d2voca1 (2voc A:2-104)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2878967Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 2878968Protein automated matches [190056] (195 species)
    not a true protein
  7. 2879094Species Bacillus subtilis [TaxId:1423] [188752] (4 PDB entries)
  8. 2879095Domain d2voca1: 2voc A:2-104 [168748]
    Other proteins in same PDB: d2voca2, d2vocb2
    automated match to d1f6mc_
    complexed with peg; mutant

Details for d2voca1

PDB Entry: 2voc (more details), 1.5 Å

PDB Description: thioredoxin a active site mutants form mixed disulfide dimers that resemble enzyme-substrate reaction intermediate
PDB Compounds: (A:) thioredoxin

SCOPe Domain Sequences for d2voca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2voca1 c.47.1.0 (A:2-104) automated matches {Bacillus subtilis [TaxId: 1423]}
aivkatdqsfsaetsegvvladfwapwcgpskmiapvleeldqemgdklkivkidvdenq
etagkygvmsiptllvlkdgevvetsvgfkpkealqelvnkhl

SCOPe Domain Coordinates for d2voca1:

Click to download the PDB-style file with coordinates for d2voca1.
(The format of our PDB-style files is described here.)

Timeline for d2voca1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2voca2