SCOPe 2.07: Domain d2vo2x_: 2vo2 X:

Lineage for d2vo2x_ (2vo2 X:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
   multihelical; consists of two all-alpha domains

4. Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families)

5. Family a.93.1.1: CCP-like [48114] (5 proteins)

6. Protein automated matches [190089] (9 species)
   not a true protein

7. Species Soybean (Glycine max) [TaxId:3847] [187116] (17 PDB entries)

8. Domain d2vo2x_: 2vo2 X: [168743]
   automated match to d1oafa_
   complexed with hem, na, so4; mutant

Details for d2vo2x_

PDB Entry: 2vo2, 1.9 Å

PDB Description: crystal structure of soybean ascorbate peroxidase mutant w41a subjected to low dose x-rays

PDB Compounds: (X:) ascorbate peroxidase

SCOPe Domain Sequences for d2vo2x_:

Sequence; same for both SEQRES and ATOM records:

>d2vo2x_ a.93.1.1 (X:) automated matches {Soybean (Glycine max) [TaxId: 3847]}
gksyptvsadyqkavekakkklrgfiaekrcaplmlrlaahsagtfdkgtktggpfgtik
hpaelahsanngldiavrlleplkaefpilsyadfyqlagvvavevtggpevpfhpgred
kpepppegrlpdatkgsdhlrdvfgkamgltdqdivalsgghtigaahkersgfegpwts
nplifdnsyftellsgekegllqlpsdkallsdpvfrplvdkyaadedaffadyaeahqk
lselgfad

Timeline for d2vo2x_:

• d2vo2x_ first appeared in SCOPe 2.01
  
• d2vo2x_ appears in SCOPe 2.06
  
• d2vo2x_ appears in the current release, SCOPe 2.08