![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily) multihelical; consists of two all-alpha domains |
![]() | Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families) ![]() |
![]() | Family a.93.1.1: CCP-like [48114] (5 proteins) |
![]() | Protein automated matches [190089] (9 species) not a true protein |
![]() | Species Soybean (Glycine max) [TaxId:3847] [187116] (17 PDB entries) |
![]() | Domain d2vo2x_: 2vo2 X: [168743] automated match to d1oafa_ complexed with hem, na, so4; mutant |
PDB Entry: 2vo2 (more details), 1.9 Å
SCOPe Domain Sequences for d2vo2x_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vo2x_ a.93.1.1 (X:) automated matches {Soybean (Glycine max) [TaxId: 3847]} gksyptvsadyqkavekakkklrgfiaekrcaplmlrlaahsagtfdkgtktggpfgtik hpaelahsanngldiavrlleplkaefpilsyadfyqlagvvavevtggpevpfhpgred kpepppegrlpdatkgsdhlrdvfgkamgltdqdivalsgghtigaahkersgfegpwts nplifdnsyftellsgekegllqlpsdkallsdpvfrplvdkyaadedaffadyaeahqk lselgfad
Timeline for d2vo2x_: