SCOPe 2.06: Domain d2vnxx_: 2vnx X:

Lineage for d2vnxx_ (2vnx X:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
   multihelical; consists of two all-alpha domains

4. Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families)

5. Family a.93.1.1: CCP-like [48114] (5 proteins)

6. Protein automated matches [190089] (8 species)
   not a true protein

7. Species Soybean (Glycine max) [TaxId:3847] [187116] (19 PDB entries)

8. Domain d2vnxx_: 2vnx X: [168739]
   automated match to d1oafa_
   complexed with hem, na; mutant

Details for d2vnxx_

PDB Entry: 2vnx, 1.5 Å

PDB Description: crystal structure of soybean ascorbate peroxidase mutant w41a after exposure to a high dose of x-rays

PDB Compounds: (X:) ascorbate peroxidase

SCOPe Domain Sequences for d2vnxx_:

Sequence; same for both SEQRES and ATOM records:

>d2vnxx_ a.93.1.1 (X:) automated matches {Soybean (Glycine max) [TaxId: 3847]}
gksyptvsadyqkavekakkklrgfiaekrcaplmlrlaahsagtfdkgtktggpfgtik
hpaelahsanngldiavrlleplkaefpilsyadfyqlagvvavevtggpevpfhpgred
kpepppegrlpdatkgsdhlrdvfgkamgltdqdivalsgghtigaahkersgfegpwts
nplifdnsyftellsgekegllqlpsdkallsdpvfrplvdkyaadedaffadyaeahqk
lselgfad

Timeline for d2vnxx_:

• d2vnxx_ first appeared in SCOPe 2.01
  
• d2vnxx_ appears in SCOPe 2.05
  
• d2vnxx_ appears in SCOPe 2.07
  
• d2vnxx_ appears in the current release, SCOPe 2.08