![]() | Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
![]() | Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
![]() | Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) ![]() shares functional and structural similarities with the ATP-grasp fold and PIPK |
![]() | Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins) members organized in the groups and subfamiles specified by the comments |
![]() | Protein automated matches [190091] (12 species) not a true protein |
![]() | Species Cow (Bos taurus) [TaxId:9913] [187007] (28 PDB entries) |
![]() | Domain d2vnwa_: 2vnw A: [168738] automated match to d1cmke_ complexed with m01 |
PDB Entry: 2vnw (more details), 2.09 Å
SCOPe Domain Sequences for d2vnwa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vnwa_ d.144.1.7 (A:) automated matches {Cow (Bos taurus) [TaxId: 9913]} svkeflakakedflkkwenpaqntahldqferiktlgtgsfgrvmlvkhmetgnhyamki ldkqkvvklkqiehtlnekrilqavnfpfltklefsfkdnsnlymvmeyapggemfshlr rigrfsepharfyaaqivltfeylhsldliyrdlkpenlmidqqgyikvtdfgfakrvkg rtwtlcgtpeylapeiilskgynkavdwwalgvliyemaagyppffadqpiqiyekivsg kvrfpshfssdlkdllrnllqvdltkrfgnlkngvndiknhkwfattdwiaiyqrkveap fipkfkgpgdtsnfddyeeeeirvsinekcgkefsef
Timeline for d2vnwa_: