SCOPe 2.05: Domain d2vnvd_: 2vnv D:

Lineage for d2vnvd_ (2vnv D:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.115: Calcium-mediated lectin [82025] (1 superfamily)
   sandwich; 9 strands in 2 sheets; greek-key

4. Superfamily b.115.1: Calcium-mediated lectin [82026] (2 families)

5. Family b.115.1.0: automated matches [191398] (1 protein)
   not a true family

6. Protein automated matches [190521] (2 species)
   not a true protein

7. Species Burkholderia cenocepacia [TaxId:216591] [188413] (5 PDB entries)

8. Domain d2vnvd_: 2vnv D: [168736]
   automated match to d1uqxa_
   complexed with ca, mma, so4

Details for d2vnvd_

PDB Entry: 2vnv, 1.7 Å

PDB Description: crystal structure of bcla lectin from burkholderia cenocepacia in complex with alpha-methyl-mannoside at 1.7 angstrom resolution

PDB Compounds: (D:) bcla

SCOPe Domain Sequences for d2vnvd_:

Sequence; same for both SEQRES and ATOM records:

>d2vnvd_ b.115.1.0 (D:) automated matches {Burkholderia cenocepacia [TaxId: 216591]}
adsqtssnragefsippntdfraiffanaaeqqhiklfigdsqepaayhklttrdgprea
tlnsgngkirfevsvngkpsatdarlapingkksdgspftvnfgivvsedghdsdyndgi
vvlqwpig

Timeline for d2vnvd_:

• d2vnvd_ first appeared in SCOPe 2.01
  
• d2vnvd_ appears in SCOPe 2.04
  
• d2vnvd_ appears in SCOPe 2.06
  
• d2vnvd_ appears in the current release, SCOPe 2.08