Lineage for d2vn9b1 (2vn9 B:11-309)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2979545Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2979546Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2984752Family d.144.1.0: automated matches [191359] (1 protein)
    not a true family
  6. 2984753Protein automated matches [190417] (37 species)
    not a true protein
  7. 2984910Species Human (Homo sapiens) [TaxId:9606] [187294] (1476 PDB entries)
  8. 2986343Domain d2vn9b1: 2vn9 B:11-309 [168729]
    Other proteins in same PDB: d2vn9a2, d2vn9b2
    automated match to d1a06a_
    complexed with cl, epe, gvd, po4

Details for d2vn9b1

PDB Entry: 2vn9 (more details), 2.3 Å

PDB Description: crystal structure of human calcium calmodulin dependent protein kinase ii delta isoform 1, camkd
PDB Compounds: (B:) Calcium/calmodulin-dependent protein kinase type II delta chain

SCOPe Domain Sequences for d2vn9b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vn9b1 d.144.1.0 (B:11-309) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tdeyqlfeelgkgafsvvrrcmkiptgqeyaakiintkklsardhqklerearicrllkh
pnivrlhdsiseegfhylvfdlvtggelfedivareyyseadashciqqilesvnhchln
givhrdlkpenlllaskskgaavkladfglaievqgdqqawfgfagtpgylspevlrkdp
ygkpvdmwacgvilyillvgyppfwdedqhrlyqqikagaydfpspewdtvtpeakdlin
kmltinpakritasealkhpwicqrstvasmmhrqetvdclkkfnarrklkgailttml

SCOPe Domain Coordinates for d2vn9b1:

Click to download the PDB-style file with coordinates for d2vn9b1.
(The format of our PDB-style files is described here.)

Timeline for d2vn9b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2vn9b2