Lineage for d2vn9a_ (2vn9 A:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1433536Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 1433537Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 1436359Family d.144.1.0: automated matches [191359] (1 protein)
    not a true family
  6. 1436360Protein automated matches [190417] (18 species)
    not a true protein
  7. 1436481Species Human (Homo sapiens) [TaxId:9606] [187294] (314 PDB entries)
  8. 1436713Domain d2vn9a_: 2vn9 A: [168728]
    automated match to d1a06a_
    complexed with cl, epe, gvd, po4

Details for d2vn9a_

PDB Entry: 2vn9 (more details), 2.3 Å

PDB Description: crystal structure of human calcium calmodulin dependent protein kinase ii delta isoform 1, camkd
PDB Compounds: (A:) Calcium/calmodulin-dependent protein kinase type II delta chain

SCOPe Domain Sequences for d2vn9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vn9a_ d.144.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
smtdeyqlfeelgkgafsvvrrcmkiptgqeyaakiintkklsardhqklerearicrll
khpnivrlhdsiseegfhylvfdlvtggelfedivareyyseadashciqqilesvnhch
lngivhrdlkpenlllaskskgaavkladfglaievqgdqqawfgfagtpgylspevlrk
dpygkpvdmwacgvilyillvgyppfwdedqhrlyqqikagaydfpspewdtvtpeakdl
inkmltinpakritasealkhpwicqrstvasmmhrqetvdclkkfnarrklkgailttm
l

SCOPe Domain Coordinates for d2vn9a_:

Click to download the PDB-style file with coordinates for d2vn9a_.
(The format of our PDB-style files is described here.)

Timeline for d2vn9a_: