Lineage for d2vmqa_ (2vmq A:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1000625Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 1000626Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 1001238Family c.67.1.4: GABA-aminotransferase-like [53417] (17 proteins)
    formerly omega-Aminoacid:pyruvate aminotransferase-like
  6. 1001441Protein Serine hydroxymethyltransferase [53429] (6 species)
  7. 1001442Species Bacillus stearothermophilus [TaxId:1422] [75272] (39 PDB entries)
  8. 1001448Domain d2vmqa_: 2vmq A: [168717]
    automated match to d1kkja_
    complexed with gly, mpd, plp, po4

Details for d2vmqa_

PDB Entry: 2vmq (more details), 1.67 Å

PDB Description: structure of n341absshmt crystallized in the presence of l-allo-thr
PDB Compounds: (A:) serine hydroxymethyltransferase

SCOPe Domain Sequences for d2vmqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vmqa_ c.67.1.4 (A:) Serine hydroxymethyltransferase {Bacillus stearothermophilus [TaxId: 1422]}
mkylpqqdpqvfaaieqerkrqhakieliasenfvsravmeaqgsvltnkyaegypgrry
yggceyvdiveelarerakqlfgaehanvqphsgaqanmavyftvlehgdtvlgmnlshg
ghlthgspvnfsgvqynfvaygvdpethvidyddvrekarlhrpklivaaasaypriidf
akfreiadevgaylmvdmahiaglvaaglhpnpvpyahfvtttthktlrgprggmilcqe
qfakqidkaifpgiqggplmhviaakavafgealqddfkayakrvvdnakrlasalqneg
ftlvsggtdnhlllvdlrpqqltgktaekvldevgitvnkatipydpespfvtsgirigt
aavttrgfgleemdeiaaiiglvlknvgseqaleearqrvaaltd

SCOPe Domain Coordinates for d2vmqa_:

Click to download the PDB-style file with coordinates for d2vmqa_.
(The format of our PDB-style files is described here.)

Timeline for d2vmqa_: