Lineage for d2vmla_ (2vml A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2685878Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2685879Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2688849Family a.1.1.3: Phycocyanin-like phycobilisome proteins [46532] (7 proteins)
    oligomers of two different types of globin-like subunits containing two extra helices at the N-terminus
    binds a bilin chromophore
    automatically mapped to Pfam PF00502
  6. 2689048Protein automated matches [190531] (23 species)
    not a true protein
  7. 2689055Species Gloeobacter violaceus [TaxId:33072] [188397] (4 PDB entries)
  8. 2689062Domain d2vmla_: 2vml A: [168702]
    automated match to d1i7ya_
    complexed with cyc

Details for d2vmla_

PDB Entry: 2vml (more details), 2.4 Å

PDB Description: the monoclinic structure of phycocyanin from gloeobacter violaceus
PDB Compounds: (A:) phycocyanin alpha chain

SCOPe Domain Sequences for d2vmla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vmla_ a.1.1.3 (A:) automated matches {Gloeobacter violaceus [TaxId: 33072]}
mktviteviasadsqgrflnntelqaangrfqratasmeaaraltsnadslvkgavqevy
nkfpyltqpgqmgygdtnqakcardishylrfityslvaggtgplddyivaglrevnrtf
nlspswyiealkhikgkvgsqlsgqplteanayidycinals

SCOPe Domain Coordinates for d2vmla_:

Click to download the PDB-style file with coordinates for d2vmla_.
(The format of our PDB-style files is described here.)

Timeline for d2vmla_: