SCOPe 2.05: Domain d2vm2b_: 2vm2 B:

Lineage for d2vm2b_ (2vm2 B:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.1: Thioltransferase [52834] (16 proteins)

6. Protein automated matches [190442] (13 species)
   not a true protein

7. Species Hordeum vulgare [TaxId:112509] [188425] (2 PDB entries)

8. Domain d2vm2b_: 2vm2 B: [168699]
   automated match to d1ti3a_

Details for d2vm2b_

PDB Entry: 2vm2, 1.8 Å

PDB Description: crystal structure of barley thioredoxin h isoform 1 crystallized using peg as precipitant

PDB Compounds: (B:) thioredoxin h isoform 1.

SCOPe Domain Sequences for d2vm2b_:

Sequence, based on SEQRES records:

>d2vm2b_ c.47.1.1 (B:) automated matches {Hordeum vulgare [TaxId: 112509]}
gaviachtkqefdthmangkdtgklviidftaswcgpcrviapvfaeyakkfpgaiflkv
dvdelkdvaeaynveamptflfikdgekvdsvvggrkddihtkivalmg

Sequence, based on observed residues (ATOM records):

>d2vm2b_ c.47.1.1 (B:) automated matches {Hordeum vulgare [TaxId: 112509]}
gaviachtkqefdthmangkdtgklviidftaswcgpcrviapvfaeyakkfpgaiflkv
dvdelkdvaeaynveamptflfikdekvdsvvggrkddihtkivalmg

Timeline for d2vm2b_:

• d2vm2b_ first appeared in SCOPe 2.01
  
• d2vm2b_ appears in SCOPe 2.04
  
• d2vm2b_ appears in SCOPe 2.06
  
• d2vm2b_ appears in the current release, SCOPe 2.08