| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) ![]() |
| Family c.47.1.1: Thioltransferase [52834] (16 proteins) |
| Protein automated matches [190442] (13 species) not a true protein |
| Species Hordeum vulgare [TaxId:112509] [188425] (2 PDB entries) |
| Domain d2vm2a_: 2vm2 A: [168698] automated match to d1ti3a_ |
PDB Entry: 2vm2 (more details), 1.8 Å
SCOPe Domain Sequences for d2vm2a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vm2a_ c.47.1.1 (A:) automated matches {Hordeum vulgare [TaxId: 112509]}
gaviachtkqefdthmangkdtgklviidftaswcgpcrviapvfaeyakkfpgaiflkv
dvdelkdvaeaynveamptflfikdgekvdsvvggrkddihtkivalmgs
Timeline for d2vm2a_: