Lineage for d2vm2a_ (2vm2 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2876128Family c.47.1.1: Thioltransferase [52834] (16 proteins)
  6. 2876445Protein automated matches [190442] (13 species)
    not a true protein
  7. 2876468Species Hordeum vulgare [TaxId:112509] [188425] (2 PDB entries)
  8. 2876473Domain d2vm2a_: 2vm2 A: [168698]
    automated match to d1ti3a_

Details for d2vm2a_

PDB Entry: 2vm2 (more details), 1.8 Å

PDB Description: crystal structure of barley thioredoxin h isoform 1 crystallized using peg as precipitant
PDB Compounds: (A:) thioredoxin h isoform 1.

SCOPe Domain Sequences for d2vm2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vm2a_ c.47.1.1 (A:) automated matches {Hordeum vulgare [TaxId: 112509]}
gaviachtkqefdthmangkdtgklviidftaswcgpcrviapvfaeyakkfpgaiflkv
dvdelkdvaeaynveamptflfikdgekvdsvvggrkddihtkivalmgs

SCOPe Domain Coordinates for d2vm2a_:

Click to download the PDB-style file with coordinates for d2vm2a_.
(The format of our PDB-style files is described here.)

Timeline for d2vm2a_: