Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.1: Thioltransferase [52834] (16 proteins) |
Protein automated matches [190442] (13 species) not a true protein |
Species Hordeum vulgare [TaxId:112509] [188425] (2 PDB entries) |
Domain d2vm1c_: 2vm1 C: [168696] automated match to d1ti3a_ complexed with so4 |
PDB Entry: 2vm1 (more details), 1.7 Å
SCOPe Domain Sequences for d2vm1c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vm1c_ c.47.1.1 (C:) automated matches {Hordeum vulgare [TaxId: 112509]} gaviachtkqefdthmangkdtgklviidftaswcgpcrviapvfaeyakkfpgaiflkv dvdelkdvaeaynveamptflfikdgekvdsvvggrkddihtkivalmgsast
Timeline for d2vm1c_: