Lineage for d2vlfb_ (2vlf B:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1613158Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 1613159Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 1613551Family c.67.1.2: Beta-eliminating lyases [53397] (3 proteins)
  6. 1613576Protein automated matches [190632] (1 species)
    not a true protein
  7. 1613577Species Citrobacter freundii [TaxId:546] [187681] (8 PDB entries)
  8. 1613589Domain d2vlfb_: 2vlf B: [168684]
    automated match to d1c7ga_
    complexed with k, p33, pge, pli

Details for d2vlfb_

PDB Entry: 2vlf (more details), 1.89 Å

PDB Description: quinonoid intermediate of citrobacter freundii tyrosine phenol-lyase formed with alanine
PDB Compounds: (B:) tyrosine phenol-lyase

SCOPe Domain Sequences for d2vlfb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vlfb_ c.67.1.2 (B:) automated matches {Citrobacter freundii [TaxId: 546]}
mnypaepfriksvetvsmiprderlkkmqeagyntfllnskdiyidlltdsgtnamsdkq
wagmmmgdeayagsenfyhlertvqelfgfkhivpthqgrgaenllsqlaikpgqyvagn
myftttryhqekngavfvdivrdeahdaglniafkgdidlkklqklidekgaeniayicl
avtvnlaggqpvsmanmravrelteahgikvfydatrcvenayfikeqeqgfenksiaei
vhemfsyadgctmsgkkdclvniggflcmnddemfssakelvvvyegmpsygglagrdme
amaiglreamqyeyiehrvkqvrylgdklkaagvpivepvgghavfldarrfcehltqde
fpaqslaasiyvetgvrsmergiisagrnnvtgehhrpkletvrltiprrvytyahmdvv
adgiiklyqhkedirglkfiyepkqlrfftarfdyi

SCOPe Domain Coordinates for d2vlfb_:

Click to download the PDB-style file with coordinates for d2vlfb_.
(The format of our PDB-style files is described here.)

Timeline for d2vlfb_: