SCOPe 2.05: Domain d1hmcb_: 1hmc B:

Lineage for d1hmcb_ (1hmc B:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.26: 4-helical cytokines [47265] (1 superfamily)
   core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections

4. Superfamily a.26.1: 4-helical cytokines [47266] (4 families)
   there are two different topoisomers of this fold with different entanglements of the two crossover connections

5. Family a.26.1.2: Short-chain cytokines [47286] (14 proteins)

6. Protein Macrophage colony-stimulating factor (M-CSF) [47295] (1 species)
   forms dimer similar to the Flt3 ligand and SCF dimers

7. Species Human (Homo sapiens) [TaxId:9606] [47296] (1 PDB entry)

8. Domain d1hmcb_: 1hmc B: [16868]
   CA-atoms only

Details for d1hmcb_

PDB Entry: 1hmc, 2.5 Å

PDB Description: three-dimensional structure of dimeric human recombinant macrophage colony stimulating factor

PDB Compounds: (B:) human macrophage colony stimulating factor

SCOPe Domain Sequences for d1hmcb_:

Sequence; same for both SEQRES and ATOM records:

>d1hmcb_ a.26.1.2 (B:) Macrophage colony-stimulating factor (M-CSF) {Human (Homo sapiens) [TaxId: 9606]}
seycshmigsghlqslqrlidsqmetscqitfefvdqeqlkdpvcylkkafllvqdimed
tmrfrdntpnaiaivqlqelslrlkscftkdyeehdkacvrtfyetplqllekvknvfne
tknlldkdwnifskncnnsfaec

Timeline for d1hmcb_:

• d1hmcb_ first appeared (with stable ids) in SCOP 1.55
  
• d1hmcb_ appears in SCOPe 2.04
  
• d1hmcb_ appears in SCOPe 2.06
  
• d1hmcb_ appears in the current release, SCOPe 2.08