SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d1hmcb_ (1hmc B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1991436Fold a.26: 4-helical cytokines [47265] (1 superfamily)
    core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections
  4. 1991437Superfamily a.26.1: 4-helical cytokines [47266] (4 families) (S)
    there are two different topoisomers of this fold with different entanglements of the two crossover connections
  5. 1991528Family a.26.1.2: Short-chain cytokines [47286] (14 protein domains)
  6. 1991658Protein Macrophage colony-stimulating factor (M-CSF) [47295] (1 species)
    forms dimer similar to the Flt3 ligand and SCF dimers
  7. 1991659Species Human (Homo sapiens) [TaxId:9606] [47296] (1 PDB entry)
  8. 1991661Domain d1hmcb_: 1hmc B: [16868]
    CA-atoms only

Details for d1hmcb_

PDB Entry: 1hmc (more details), 2.5 Å

PDB Description: three-dimensional structure of dimeric human recombinant macrophage colony stimulating factor
PDB Compounds: (B:) human macrophage colony stimulating factor

SCOPe Domain Sequences for d1hmcb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hmcb_ a.26.1.2 (B:) Macrophage colony-stimulating factor (M-CSF) {Human (Homo sapiens) [TaxId: 9606]}
seycshmigsghlqslqrlidsqmetscqitfefvdqeqlkdpvcylkkafllvqdimed
tmrfrdntpnaiaivqlqelslrlkscftkdyeehdkacvrtfyetplqllekvknvfne
tknlldkdwnifskncnnsfaec

SCOPe Domain Coordinates for d1hmcb_:

Click to download the PDB-style file with coordinates for d1hmcb_.
(The format of our PDB-style files is described here.)

Timeline for d1hmcb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1hmca_