SCOPe 2.04: Domain d2vl6b_: 2vl6 B:

Lineage for d2vl6b_ (2vl6 B:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.40: OB-fold [50198] (16 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families)

5. Family b.40.4.0: automated matches [191416] (1 protein)
   not a true family

6. Protein automated matches [190576] (22 species)
   not a true protein

7. Species Sulfolobus solfataricus [TaxId:2287] [188424] (3 PDB entries)

8. Domain d2vl6b_: 2vl6 B: [168677]
   automated match to d1ltle_
   complexed with zn

Details for d2vl6b_

PDB Entry: 2vl6, 2.8 Å

PDB Description: structural analysis of the sulfolobus solfataricus mcm protein n- terminal domain

PDB Compounds: (B:) minichromosome maintenance protein mcm

SCOPe Domain Sequences for d2vl6b_:

Sequence; same for both SEQRES and ATOM records:

>d2vl6b_ b.40.4.0 (B:) automated matches {Sulfolobus solfataricus [TaxId: 2287]}
qidyrdvfieflttfkgnnnqnkyierinelvayrkksliiefsdvlsfnenlayeiinn
tkiilpilegalydhilqldptyqrdiekvhvrivgiprvielrkirstdigklitidgi
lvkvtpvkeriykatykhihpdcmqefewpedeempevlempticpkcgkpgqfrlipek
tklidwqkaviqerpeevpsgqlprqleiileddlvdsarpgdrvkvtgildikqdspvk
rgsravfdiymkvssievs

Timeline for d2vl6b_:

• d2vl6b_ first appeared in SCOPe 2.01
  
• d2vl6b_ appears in SCOPe 2.03
  
• d2vl6b_ appears in SCOPe 2.05
  
• d2vl6b_ appears in the current release, SCOPe 2.07