Lineage for d2vkrf_ (2vkr F:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2949055Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (7 families) (S)
  5. 2949182Family d.58.1.3: Archaeal ferredoxins [54874] (2 proteins)
  6. 2949186Protein automated matches [190908] (1 species)
    not a true protein
  7. 2949187Species Acidianus ambivalens [TaxId:2283] [188362] (1 PDB entry)
  8. 2949193Domain d2vkrf_: 2vkr F: [168674]
    automated match to d1xera_
    complexed with f3s, sf4, zn

Details for d2vkrf_

PDB Entry: 2vkr (more details), 2.01 Å

PDB Description: 3fe-4s, 4fe-4s plus zn acidianus ambivalens ferredoxin
PDB Compounds: (F:) zinc-containing ferredoxin

SCOPe Domain Sequences for d2vkrf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vkrf_ d.58.1.3 (F:) automated matches {Acidianus ambivalens [TaxId: 2283]}
gidpnyrtsrqvvgehqghkvygpvdppkvlgihgtivgvdfdlciadgscitacpvnvf
qwydtpghpasekkadpineqacifcmacvnvcpvaaidvkpp

SCOPe Domain Coordinates for d2vkrf_:

Click to download the PDB-style file with coordinates for d2vkrf_.
(The format of our PDB-style files is described here.)

Timeline for d2vkrf_: