Lineage for d1hmca1 (1hmc A:4-149)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2705447Fold a.26: 4-helical cytokines [47265] (1 superfamily)
    core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections
  4. 2705448Superfamily a.26.1: 4-helical cytokines [47266] (4 families) (S)
    there are two different topoisomers of this fold with different entanglements of the two crossover connections
  5. 2705548Family a.26.1.2: Short-chain cytokines [47286] (14 proteins)
  6. 2705698Protein Macrophage colony-stimulating factor (M-CSF) [47295] (1 species)
    forms dimer similar to the Flt3 ligand and SCF dimers
  7. 2705699Species Human (Homo sapiens) [TaxId:9606] [47296] (1 PDB entry)
  8. 2705700Domain d1hmca1: 1hmc A:4-149 [16867]
    Other proteins in same PDB: d1hmca2
    CA-atoms only

Details for d1hmca1

PDB Entry: 1hmc (more details), 2.5 Å

PDB Description: three-dimensional structure of dimeric human recombinant macrophage colony stimulating factor
PDB Compounds: (A:) human macrophage colony stimulating factor

SCOPe Domain Sequences for d1hmca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hmca1 a.26.1.2 (A:4-149) Macrophage colony-stimulating factor (M-CSF) {Human (Homo sapiens) [TaxId: 9606]}
seycshmigsghlqslqrlidsqmetscqitfefvdqeqlkdpvcylkkafllvqdimed
tmrfrdntpnaiaivqlqelslrlkscftkdyeehdkacvrtfyetplqllekvknvfne
tknlldkdwnifskncnnsfaecssq

SCOPe Domain Coordinates for d1hmca1:

Click to download the PDB-style file with coordinates for d1hmca1.
(The format of our PDB-style files is described here.)

Timeline for d1hmca1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1hmca2
View in 3D
Domains from other chains:
(mouse over for more information)
d1hmcb_