Lineage for d2vkra_ (2vkr A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1906287Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1906288Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (7 families) (S)
  5. 1906372Family d.58.1.3: Archaeal ferredoxins [54874] (2 proteins)
  6. 1906376Protein automated matches [190908] (1 species)
    not a true protein
  7. 1906377Species Acidianus ambivalens [TaxId:2283] [188362] (1 PDB entry)
  8. 1906378Domain d2vkra_: 2vkr A: [168669]
    automated match to d1xera_
    complexed with f3s, sf4, zn

Details for d2vkra_

PDB Entry: 2vkr (more details), 2.01 Å

PDB Description: 3fe-4s, 4fe-4s plus zn acidianus ambivalens ferredoxin
PDB Compounds: (A:) zinc-containing ferredoxin

SCOPe Domain Sequences for d2vkra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vkra_ d.58.1.3 (A:) automated matches {Acidianus ambivalens [TaxId: 2283]}
gidpnyrtsrqvvgehqghkvygpvdppkvlgihgtivgvdfdlciadgscitacpvnvf
qwydtpghpasekkadpineqacifcmacvnvcpvaaidvkpp

SCOPe Domain Coordinates for d2vkra_:

Click to download the PDB-style file with coordinates for d2vkra_.
(The format of our PDB-style files is described here.)

Timeline for d2vkra_: