![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (7 families) ![]() |
![]() | Family d.58.1.3: Archaeal ferredoxins [54874] (2 proteins) |
![]() | Protein automated matches [190908] (1 species) not a true protein |
![]() | Species Acidianus ambivalens [TaxId:2283] [188362] (1 PDB entry) |
![]() | Domain d2vkra_: 2vkr A: [168669] automated match to d1xera_ complexed with f3s, sf4, zn |
PDB Entry: 2vkr (more details), 2.01 Å
SCOPe Domain Sequences for d2vkra_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vkra_ d.58.1.3 (A:) automated matches {Acidianus ambivalens [TaxId: 2283]} gidpnyrtsrqvvgehqghkvygpvdppkvlgihgtivgvdfdlciadgscitacpvnvf qwydtpghpasekkadpineqacifcmacvnvcpvaaidvkpp
Timeline for d2vkra_: