![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.55: PH domain-like barrel [50728] (3 superfamilies) barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix |
![]() | Superfamily b.55.1: PH domain-like [50729] (14 families) ![]() |
![]() | Family b.55.1.1: Pleckstrin-homology domain (PH domain) [50730] (48 proteins) Pfam PF00169 |
![]() | Protein automated matches [190063] (3 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187187] (8 PDB entries) |
![]() | Domain d2vkia_: 2vki A: [168664] automated match to d1w1hb_ complexed with gol, so4; mutant |
PDB Entry: 2vki (more details), 1.8 Å
SCOPe Domain Sequences for d2vkia_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vkia_ b.55.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} snieqyihdldsnsfeldlqfsedekrlllekqaggnpwhqfvennlilkmgpvderkgl farrrqllltegphlyyvdpvnkvlkgeipwsqelrpeaknfktffvhtpnrtyylmdps gnahkwcrkiqevwrqryqs
Timeline for d2vkia_: