Lineage for d2vkia_ (2vki A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2803065Fold b.55: PH domain-like barrel [50728] (3 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 2803066Superfamily b.55.1: PH domain-like [50729] (14 families) (S)
  5. 2803067Family b.55.1.1: Pleckstrin-homology domain (PH domain) [50730] (48 proteins)
    Pfam PF00169
  6. 2803336Protein automated matches [190063] (3 species)
    not a true protein
  7. 2803342Species Human (Homo sapiens) [TaxId:9606] [187187] (8 PDB entries)
  8. 2803343Domain d2vkia_: 2vki A: [168664]
    automated match to d1w1hb_
    complexed with gol, so4; mutant

Details for d2vkia_

PDB Entry: 2vki (more details), 1.8 Å

PDB Description: structure of the pdk1 ph domain k465e mutant
PDB Compounds: (A:) 3-phopshoinositide dependent protein kinase 1

SCOPe Domain Sequences for d2vkia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vkia_ b.55.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
snieqyihdldsnsfeldlqfsedekrlllekqaggnpwhqfvennlilkmgpvderkgl
farrrqllltegphlyyvdpvnkvlkgeipwsqelrpeaknfktffvhtpnrtyylmdps
gnahkwcrkiqevwrqryqs

SCOPe Domain Coordinates for d2vkia_:

Click to download the PDB-style file with coordinates for d2vkia_.
(The format of our PDB-style files is described here.)

Timeline for d2vkia_: