Lineage for d2vk3a_ (2vk3 A:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1037952Fold d.110: Profilin-like [55769] (10 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 1037953Superfamily d.110.1: Profilin (actin-binding protein) [55770] (2 families) (S)
    alpha-beta(2)-alpha-beta(5)-alpha
  5. 1037954Family d.110.1.1: Profilin (actin-binding protein) [55771] (2 proteins)
  6. 1037994Protein automated matches [190412] (3 species)
    not a true protein
  7. 1038001Species Norway rat (Rattus norvegicus) [TaxId:10116] [188780] (1 PDB entry)
  8. 1038002Domain d2vk3a_: 2vk3 A: [168663]
    automated match to d1d1ja_
    complexed with dtu, gol, so4

Details for d2vk3a_

PDB Entry: 2vk3 (more details), 1.7 Å

PDB Description: crystal structure of rat profilin 2a
PDB Compounds: (A:) profilin-2

SCOPe Domain Sequences for d2vk3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vk3a_ d.110.1.1 (A:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
gsmagwqsyvdnlmcdgccqeaaivgycdakyvwaataggvfqsitpaeidviigkdreg
fftngltlggkkcsvirdslyvdsdctmdirtksqggeptynvavgragrvlvfvmgkeg
vhggglnkkaysmakylrdsgf

SCOPe Domain Coordinates for d2vk3a_:

Click to download the PDB-style file with coordinates for d2vk3a_.
(The format of our PDB-style files is described here.)

Timeline for d2vk3a_: