SCOPe 2.08: Domain d2vjta_: 2vjt A:

Lineage for d2vjta_ (2vjt A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.3: Phycocyanin-like phycobilisome proteins [46532] (7 proteins)
   oligomers of two different types of globin-like subunits containing two extra helices at the N-terminus
   binds a bilin chromophore
   automatically mapped to Pfam PF00502

6. Protein automated matches [190531] (23 species)
   not a true protein

7. Species Gloeobacter violaceus [TaxId:33072] [188397] (4 PDB entries)

8. Domain d2vjta_: 2vjt A: [168661]
   automated match to d1kn1a_
   complexed with cyc

Details for d2vjta_

PDB Entry: 2vjt, 2.5 Å

PDB Description: the structure of allophycocyanin from gloeobacter violaceus

PDB Compounds: (A:) allophycocyanin alpha subunit

SCOPe Domain Sequences for d2vjta_:

Sequence; same for both SEQRES and ATOM records:

>d2vjta_ a.1.1.3 (A:) automated matches {Gloeobacter violaceus [TaxId: 33072]}
svltkaivnadaearylspgeldriksfvasgerrlriaqtltearerivkqagdqlfqi
rpdvvspggnaygekmtalclrdldyylrlvtygivagdvtpieeigiigvkemynslqt
pipavaegvramknvatsllsgddaaeagfyfdylvgamq

Timeline for d2vjta_:

• d2vjta_ first appeared in SCOPe 2.01
  
• d2vjta_ appears in SCOPe 2.07