Lineage for d1hulb_ (1hul B:)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 2641Fold a.26: 4-helical cytokines [47265] (1 superfamily)
  4. 2642Superfamily a.26.1: 4-helical cytokines [47266] (3 families) (S)
  5. 2696Family a.26.1.2: Short-chain cytokines [47286] (9 proteins)
  6. 2736Protein Interleukin-5 [47293] (1 species)
  7. 2737Species Human (Homo sapiens) [TaxId:9606] [47294] (1 PDB entry)
  8. 2739Domain d1hulb_: 1hul B: [16866]

Details for d1hulb_

PDB Entry: 1hul (more details), 2.4 Å

PDB Description: a novel dimer configuration revealed by the crystal structure at 2.4 angstroms resolution of human interleukin-5

SCOP Domain Sequences for d1hulb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hulb_ a.26.1.2 (B:) Interleukin-5 {Human (Homo sapiens)}
iptsalvketlallsthrtllianetlripvpvhknhqlcteeifqgigtlesqtvqggt
verlfknlslikkyidgqkkkcgeerrrvnqfldylqeflgvmntewi

SCOP Domain Coordinates for d1hulb_:

Click to download the PDB-style file with coordinates for d1hulb_.
(The format of our PDB-style files is described here.)

Timeline for d1hulb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1hula_