| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.26: 4-helical cytokines [47265] (1 superfamily) core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections |
Superfamily a.26.1: 4-helical cytokines [47266] (4 families) ![]() there are two different topoisomers of this fold with different entanglements of the two crossover connections |
| Family a.26.1.2: Short-chain cytokines [47286] (14 proteins) |
| Protein Interleukin-5 [47293] (1 species) intertwined dimer |
| Species Human (Homo sapiens) [TaxId:9606] [47294] (1 PDB entry) |
| Domain d1hulb_: 1hul B: [16866] |
PDB Entry: 1hul (more details), 2.4 Å
SCOPe Domain Sequences for d1hulb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hulb_ a.26.1.2 (B:) Interleukin-5 {Human (Homo sapiens) [TaxId: 9606]}
iptsalvketlallsthrtllianetlripvpvhknhqlcteeifqgigtlesqtvqggt
verlfknlslikkyidgqkkkcgeerrrvnqfldylqeflgvmntewi
Timeline for d1hulb_: