Lineage for d2vjpa_ (2vjp A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2150853Fold c.123: CoA-transferase family III (CaiB/BaiF) [89795] (1 superfamily)
    consist of two different alpha/beta domains; N-terminal domain has a SurE-like topology with a left-handed beta-alpha-beta unit
  4. 2150854Superfamily c.123.1: CoA-transferase family III (CaiB/BaiF) [89796] (2 families) (S)
  5. 2150855Family c.123.1.1: CoA-transferase family III (CaiB/BaiF) [89797] (5 protein domains)
    forms interlocked homodimer of two ring-like subunits
  6. 2150923Protein automated matches [190402] (3 species)
    not a true protein
  7. 2150930Species Oxalobacter formigenes [TaxId:847] [187276] (7 PDB entries)
  8. 2150937Domain d2vjpa_: 2vjp A: [168653]
    automated match to d1p5ha_
    complexed with na; mutant

Details for d2vjpa_

PDB Entry: 2vjp (more details), 1.95 Å

PDB Description: formyl-coa transferase mutant variant w48f
PDB Compounds: (A:) Formyl-coenzyme A transferase

SCOPe Domain Sequences for d2vjpa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vjpa_ c.123.1.1 (A:) automated matches {Oxalobacter formigenes [TaxId: 847]}
tkpldginvldfthvqagpactqmmgflganvikierrgsgdmtrgflqdkpnvdslyft
mfncnkrsieldmktpegkelleqmikkadvmvenfgpgaldrmgftweyiqelnprvil
asvkgyaeghanehlkvyenvaqcsggaaattgfwdgpptvsgaalgdsnsgmhlmigil
aaleirhktgrgqkvavamqdavlnlvriklrdqqrlertgilaeypqaqpnfafdrdgn
plsfdnitsvprggnaggggqpgwmlkckgwetdadsyvyftiaanmwpqicdmidkpew
kddpayntfegrvdklmdifsfietkfadkdkfevtewaaqygipcgpvmsmkelahdps
lqkvgtvvevvdeirgnhltvgapfkfsgfqpeitrapllgehtdevlkelglddakike
lhakqvv

SCOPe Domain Coordinates for d2vjpa_:

Click to download the PDB-style file with coordinates for d2vjpa_.
(The format of our PDB-style files is described here.)

Timeline for d2vjpa_: