![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.123: CoA-transferase family III (CaiB/BaiF) [89795] (1 superfamily) consist of two different alpha/beta domains; N-terminal domain has a SurE-like topology with a left-handed beta-alpha-beta unit |
![]() | Superfamily c.123.1: CoA-transferase family III (CaiB/BaiF) [89796] (2 families) ![]() |
![]() | Family c.123.1.1: CoA-transferase family III (CaiB/BaiF) [89797] (5 proteins) forms interlocked homodimer of two ring-like subunits |
![]() | Protein automated matches [190402] (3 species) not a true protein |
![]() | Species Oxalobacter formigenes [TaxId:847] [187276] (7 PDB entries) |
![]() | Domain d2vjob_: 2vjo B: [168652] automated match to d1p5ha_ complexed with cl, coa, epe, oxl; mutant |
PDB Entry: 2vjo (more details), 2.2 Å
SCOPe Domain Sequences for d2vjob_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vjob_ c.123.1.1 (B:) automated matches {Oxalobacter formigenes [TaxId: 847]} tkpldginvldfthvaagpactqmmgflganvikierrgsgdmtrgwlqdkpnvdslyft mfncnkrsieldmktpegkelleqmikkadvmvenfgpgaldrmgftweyiqelnprvil asvkgyaeghanehlkvyenvaqcsggaaattgfwdgpptvsgaalgdsnsgmhlmigil aaleirhktgrgqkvavamqdavlnlvriklrdqqrlertgilaeypqaqpnfafdrdgn plsfdnitsvprggnaggggqpgwmlkckgwetdadsyvyftiaanmwpqicdmidkpew kddpayntfegrvdklmdifsfietkfadkdkfevtewaaqygipcgpvmsmkelahdps lqkvgtvvevvdeirgnhltvgapfkfsgfqpeitrapllgehtdevlkelglddakike lhakqvv
Timeline for d2vjob_: