SCOPe 2.08: Domain d1hula_: 1hul A:

Lineage for d1hula_ (1hul A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.26: 4-helical cytokines [47265] (1 superfamily)
   core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections

4. Superfamily a.26.1: 4-helical cytokines [47266] (4 families)
   there are two different topoisomers of this fold with different entanglements of the two crossover connections

5. Family a.26.1.2: Short-chain cytokines [47286] (14 proteins)

6. Protein Interleukin-5 [47293] (1 species)
   intertwined dimer

7. Species Human (Homo sapiens) [TaxId:9606] [47294] (1 PDB entry)

8. Domain d1hula_: 1hul A: [16865]

Details for d1hula_

PDB Entry: 1hul, 2.4 Å

PDB Description: a novel dimer configuration revealed by the crystal structure at 2.4 angstroms resolution of human interleukin-5

PDB Compounds: (A:) Interleukin-5

SCOPe Domain Sequences for d1hula_:

Sequence; same for both SEQRES and ATOM records:

>d1hula_ a.26.1.2 (A:) Interleukin-5 {Human (Homo sapiens) [TaxId: 9606]}
iptsalvketlallsthrtllianetlripvpvhknhqlcteeifqgigtlesqtvqggt
verlfknlslikkyidgqkkkcgeerrrvnqfldylqeflgvmntewi

Timeline for d1hula_:

• d1hula_ first appeared (with stable ids) in SCOP 1.55
  
• d1hula_ appears in SCOPe 2.07