SCOPe 2.01: Domain d2vjhd_: 2vjh D:

Lineage for d2vjhd_ (2vjh D:)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.3: Phycocyanin-like phycobilisome proteins [46532] (7 proteins)
   oligomers of two different types of globin-like subunits containing two extra helices at the N-terminus
   binds a bilin chromophore

6. Protein automated matches [190531] (6 species)
   not a true protein

7. Species Gloeobacter violaceus [TaxId:33072] [188397] (4 PDB entries)

8. Domain d2vjhd_: 2vjh D: [168648]
   automated match to d1qgwd_
   complexed with peb, pub

Details for d2vjhd_

PDB Entry: 2vjh, 2.2 Å

PDB Description: the structure of phycoerythrin from gloeobacter violaceus

PDB Compounds: (D:) phycoerythrin beta subunit

SCOPe Domain Sequences for d2vjhd_:

Sequence; same for both SEQRES and ATOM records:

>d2vjhd_ a.1.1.3 (D:) automated matches {Gloeobacter violaceus [TaxId: 33072]}
mldafskavvsadqktgyiggaelaalktyiangnkrldavnaitsnascivsdavsgmi
cenpglisaggncytnrrmaaclrdgeivlryvtyallagdasvledrclnglketymal
gvpipsairavsimkasavafinntaskrkietpqgdcaalaseagsyfdmaasalr

Timeline for d2vjhd_:

• d2vjhd_ is new in SCOPe 2.01-stable
  
• d2vjhd_ appears in SCOPe 2.02
  
• d2vjhd_ appears in the current release, SCOPe 2.08