SCOPe 2.04: Domain d2vjhb_: 2vjh B:

Lineage for d2vjhb_ (2vjh B:)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.3: Phycocyanin-like phycobilisome proteins [46532] (7 proteins)
   oligomers of two different types of globin-like subunits containing two extra helices at the N-terminus
   binds a bilin chromophore
   automatically mapped to Pfam PF00502

6. Protein automated matches [190531] (15 species)
   not a true protein

7. Species Gloeobacter violaceus [TaxId:33072] [188397] (4 PDB entries)

8. Domain d2vjhb_: 2vjh B: [168646]
   automated match to d1qgwd_
   complexed with peb, pub

Details for d2vjhb_

PDB Entry: 2vjh, 2.2 Å

PDB Description: the structure of phycoerythrin from gloeobacter violaceus

PDB Compounds: (B:) phycoerythrin beta subunit

SCOPe Domain Sequences for d2vjhb_:

Sequence; same for both SEQRES and ATOM records:

>d2vjhb_ a.1.1.3 (B:) automated matches {Gloeobacter violaceus [TaxId: 33072]}
mldafskavvsadqktgyiggaelaalktyiangnkrldavnaitsnascivsdavsgmi
cenpglisaggncytnrrmaaclrdgeivlryvtyallagdasvledrclnglketymal
gvpipsairavsimkasavafinntaskrkietpqgdcaalaseagsyfdmaasalr

Timeline for d2vjhb_:

• d2vjhb_ first appeared in SCOPe 2.01
  
• d2vjhb_ appears in SCOPe 2.03
  
• d2vjhb_ appears in SCOPe 2.05
  
• d2vjhb_ appears in the current release, SCOPe 2.08