Lineage for d2vjhb_ (2vjh B:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1253685Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1253686Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1255931Family a.1.1.3: Phycocyanin-like phycobilisome proteins [46532] (7 proteins)
    oligomers of two different types of globin-like subunits containing two extra helices at the N-terminus
    binds a bilin chromophore
    automatically mapped to Pfam PF00502
  6. 1256091Protein automated matches [190531] (8 species)
    not a true protein
  7. 1256092Species Gloeobacter violaceus [TaxId:33072] [188397] (4 PDB entries)
  8. 1256094Domain d2vjhb_: 2vjh B: [168646]
    automated match to d1qgwd_
    complexed with peb, pub

Details for d2vjhb_

PDB Entry: 2vjh (more details), 2.2 Å

PDB Description: the structure of phycoerythrin from gloeobacter violaceus
PDB Compounds: (B:) phycoerythrin beta subunit

SCOPe Domain Sequences for d2vjhb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vjhb_ a.1.1.3 (B:) automated matches {Gloeobacter violaceus [TaxId: 33072]}
mldafskavvsadqktgyiggaelaalktyiangnkrldavnaitsnascivsdavsgmi
cenpglisaggncytnrrmaaclrdgeivlryvtyallagdasvledrclnglketymal
gvpipsairavsimkasavafinntaskrkietpqgdcaalaseagsyfdmaasalr

SCOPe Domain Coordinates for d2vjhb_:

Click to download the PDB-style file with coordinates for d2vjhb_.
(The format of our PDB-style files is described here.)

Timeline for d2vjhb_: