SCOPe 2.06: Domain d2vjha_: 2vjh A:

Lineage for d2vjha_ (2vjh A:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.3: Phycocyanin-like phycobilisome proteins [46532] (7 proteins)
   oligomers of two different types of globin-like subunits containing two extra helices at the N-terminus
   binds a bilin chromophore
   automatically mapped to Pfam PF00502

6. Protein automated matches [190531] (18 species)
   not a true protein

7. Species Gloeobacter violaceus [TaxId:33072] [188397] (4 PDB entries)

8. Domain d2vjha_: 2vjh A: [168645]
   automated match to d1b8da_
   complexed with peb, pub

Details for d2vjha_

PDB Entry: 2vjh, 2.2 Å

PDB Description: the structure of phycoerythrin from gloeobacter violaceus

PDB Compounds: (A:) phycoerythrin alpha chain

SCOPe Domain Sequences for d2vjha_:

Sequence; same for both SEQRES and ATOM records:

>d2vjha_ a.1.1.3 (A:) automated matches {Gloeobacter violaceus [TaxId: 33072]}
mksvvttvlaaadaagrfpsgsdlesvqgniqrsaarleaaeklaaghaavvkeagdvvf
kkypylktageagdsaekvakcyrdidhymrlinyclvvggtgpldewgisgarevyral
nlptaayvaafqytrdracaprdmgpqaltefrsyldyvinals

Timeline for d2vjha_:

• d2vjha_ first appeared in SCOPe 2.01
  
• d2vjha_ appears in SCOPe 2.05
  
• d2vjha_ appears in SCOPe 2.07
  
• d2vjha_ appears in the current release, SCOPe 2.08