Lineage for d2vj9a_ (2vj9 A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2058814Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 2058815Superfamily b.50.1: Acid proteases [50630] (4 families) (S)
  5. 2060177Family b.50.1.2: Pepsin-like [50646] (11 protein domains)
    duplication: consists of two similar barrel domains
    N-terminal: barrel, partly opened; n*=6, S*=10
  6. 2060948Protein automated matches [190156] (4 species)
    not a true protein
  7. 2060973Species Human (Homo sapiens) [TaxId:9606] [187237] (38 PDB entries)
  8. 2060978Domain d2vj9a_: 2vj9 A: [168644]
    automated match to d1w50a_
    complexed with vg7

Details for d2vj9a_

PDB Entry: 2vj9 (more details), 1.6 Å

PDB Description: human bace-1 in complex with n-((1s,2r)-3-(cyclohexylamino)-2-hydroxy-1-(phenylmethyl)propyl)-3-(ethylamino)-5-(2-oxo-1-pyrrolidinyl)benzamide
PDB Compounds: (A:) Beta-secretase 1

SCOPe Domain Sequences for d2vj9a_:

Sequence, based on SEQRES records: (download)

>d2vj9a_ b.50.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
emvdnlrgksgqgyyvemtvgsppqtlnilvdtgssnfavgaaphpflhryyqrqlssty
rdlrkgvyvpytqgkwegelgtdlvsiphgpqvtvraniaaitesdkffiqgsnwegilg
layaeiarpddslepffdslvkqthvpnlfslqlcgagfplqqsevlasvggsmiiggid
hslytgslwytpirrewyyeviivrveingqdlkmdckeynydksivdsgttnlrlpkkv
feaavksikaasstekfpdgfwlgeqlvcwqagttpwnifpvislylmgevtqqsfriti
lpqqylrpvedvatsqddcykfaisqsstgtvmgavimegfyvvfdrarkrigfavsach
vhdefrtaavegpfvtldmedcgynipqtd

Sequence, based on observed residues (ATOM records): (download)

>d2vj9a_ b.50.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
emvdnlrgksgqgyyvemtvgsppqtlnilvdtgssnfavgaaphpflhryyqrqlssty
rdlrkgvyvpytqgkwegelgtdlvsiphgpqvtvraniaaitesdkffiqgsnwegilg
layaeiarpddslepffdslvkqthvpnlfslqlcggsmiiggidhslytgslwytpirr
ewyyeviivrveingqdlkmdckeynydksivdsgttnlrlpkkvfeaavksikaasste
kfpdgfwlgeqlvcwqagttpwnifpvislylmgevtqqsfritilpqqylrpvedvats
qddcykfaisqsstgtvmgavimegfyvvfdrarkrigfavsachvhdefrtaavegpfv
tldmedcgynipqtd

SCOPe Domain Coordinates for d2vj9a_:

Click to download the PDB-style file with coordinates for d2vj9a_.
(The format of our PDB-style files is described here.)

Timeline for d2vj9a_: