Lineage for d2vj6a_ (2vj6 A:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1130027Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 1130028Superfamily b.50.1: Acid proteases [50630] (4 families) (S)
  5. 1131149Family b.50.1.2: Pepsin-like [50646] (11 proteins)
    duplication: consists of two similar barrel domains
    N-terminal: barrel, partly opened; n*=6, S*=10
  6. 1131671Protein automated matches [190156] (4 species)
    not a true protein
  7. 1131696Species Human (Homo sapiens) [TaxId:9606] [187237] (35 PDB entries)
  8. 1131708Domain d2vj6a_: 2vj6 A: [168642]
    automated match to d1w50a_
    complexed with vg5

Details for d2vj6a_

PDB Entry: 2vj6 (more details), 1.8 Å

PDB Description: human bace-1 in complex with n-((1s,2r)-3-(((1s)-2-(cyclohexylamino)- 1-methyl-2-oxoethyl)amino)-2-hydroxy-1-(phenylmethyl)propyl)-3- (ethylamino)-5-(2-oxo-1-pyrrolidinyl)benzamide
PDB Compounds: (A:) Beta-secretase 1

SCOPe Domain Sequences for d2vj6a_:

Sequence, based on SEQRES records: (download)

>d2vj6a_ b.50.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
emvdnlrgksgqgyyvemtvgsppqtlnilvdtgssnfavgaaphpflhryyqrqlssty
rdlrkgvyvpytqgkwegelgtdlvsiphgpqvtvraniaaitesdkffiqgsnwegilg
layaeiarpddslepffdslvkqthvpnlfslqlcgagfplqqsevlasvggsmiiggid
hslytgslwytpirrewyyeviivrveingqdlkmdckeynydksivdsgttnlrlpkkv
feaavksikaasstekfpdgfwlgeqlvcwqagttpwnifpvislylmgevtqqsfriti
lpqqylrpvedvatsqddcykfaisqsstgtvmgavimegfyvvfdrarkrigfavsach
vhdefrtaavegpfvtldmedcgyni

Sequence, based on observed residues (ATOM records): (download)

>d2vj6a_ b.50.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
emvdnlrgksgqgyyvemtvgsppqtlnilvdtgssnfavgaaphpflhryyqrqlssty
rdlrkgvyvpytqgkwegelgtdlvsiphgpqvtvraniaaitesdkffiqgsnwegilg
layaeiarpddslepffdslvkqthvpnlfslqlcggsmiiggidhslytgslwytpirr
ewyyeviivrveingqdlkmdckeynydksivdsgttnlrlpkkvfeaavksikaasste
kfpdgfwlgeqlvcwqagttpwnifpvislylmgevtqqsfritilpqqylrpvedvats
qddcykfaisqsstgtvmgavimegfyvvfdrarkrigfavsachvhdefrtaavegpfv
tldmedcgyni

SCOPe Domain Coordinates for d2vj6a_:

Click to download the PDB-style file with coordinates for d2vj6a_.
(The format of our PDB-style files is described here.)

Timeline for d2vj6a_: