SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d2vi6f_ (2vi6 F:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1981147Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1981148Superfamily a.4.1: Homeodomain-like [46689] (20 families) (S)
    consists only of helices
  5. 1982024Family a.4.1.0: automated matches [191447] (1 protein)
    not a true family
  6. 1982025Protein automated matches [190674] (21 species)
    not a true protein
  7. 1982086Species Mouse (Mus musculus) [TaxId:10090] [188321] (5 PDB entries)
  8. 1982093Domain d2vi6f_: 2vi6 F: [168630]
    automated match to d1ftta_

Details for d2vi6f_

PDB Entry: 2vi6 (more details), 2.6 Å

PDB Description: crystal structure of the nanog homeodomain
PDB Compounds: (F:) homeobox protein nanog

SCOPe Domain Sequences for d2vi6f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vi6f_ a.4.1.0 (F:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
tvfsqaqlcalkdrfqkqkylslqqmqelssilnlsykqvktwfqnqrmkckrwq

SCOPe Domain Coordinates for d2vi6f_:

Click to download the PDB-style file with coordinates for d2vi6f_.
(The format of our PDB-style files is described here.)

Timeline for d2vi6f_: