Class a: All alpha proteins [46456] (290 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.1: Homeodomain-like [46689] (21 families) consists only of helices |
Family a.4.1.0: automated matches [191447] (1 protein) not a true family |
Protein automated matches [190674] (25 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [188321] (5 PDB entries) |
Domain d2vi6f_: 2vi6 F: [168630] automated match to d1ftta_ |
PDB Entry: 2vi6 (more details), 2.6 Å
SCOPe Domain Sequences for d2vi6f_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vi6f_ a.4.1.0 (F:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} tvfsqaqlcalkdrfqkqkylslqqmqelssilnlsykqvktwfqnqrmkckrwq
Timeline for d2vi6f_: