Lineage for d2vi6e_ (2vi6 E:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2305222Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2305223Superfamily a.4.1: Homeodomain-like [46689] (20 families) (S)
    consists only of helices
  5. 2306149Family a.4.1.0: automated matches [191447] (1 protein)
    not a true family
  6. 2306150Protein automated matches [190674] (25 species)
    not a true protein
  7. 2306249Species Mouse (Mus musculus) [TaxId:10090] [188321] (5 PDB entries)
  8. 2306255Domain d2vi6e_: 2vi6 E: [168629]
    automated match to d1ftta_

Details for d2vi6e_

PDB Entry: 2vi6 (more details), 2.6 Å

PDB Description: crystal structure of the nanog homeodomain
PDB Compounds: (E:) homeobox protein nanog

SCOPe Domain Sequences for d2vi6e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vi6e_ a.4.1.0 (E:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
vfsqaqlcalkdrfqkqkylslqqmqelssilnlsykqvktwfqnqrmkckrwq

SCOPe Domain Coordinates for d2vi6e_:

Click to download the PDB-style file with coordinates for d2vi6e_.
(The format of our PDB-style files is described here.)

Timeline for d2vi6e_: