SCOPe 2.08: Domain d2vi6c_: 2vi6 C:

Lineage for d2vi6c_ (2vi6 C:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.1: Homeodomain-like [46689] (21 families)
   consists only of helices

5. Family a.4.1.0: automated matches [191447] (1 protein)
   not a true family

6. Protein automated matches [190674] (25 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188321] (5 PDB entries)

8. Domain d2vi6c_: 2vi6 C: [168627]
   automated match to d1ftta_

Details for d2vi6c_

PDB Entry: 2vi6, 2.6 Å

PDB Description: crystal structure of the nanog homeodomain

PDB Compounds: (C:) homeobox protein nanog

SCOPe Domain Sequences for d2vi6c_:

Sequence; same for both SEQRES and ATOM records:

>d2vi6c_ a.4.1.0 (C:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
tvfsqaqlcalkdrfqkqkylslqqmqelssilnlsykqvktwfqnqrmkckrwq

Timeline for d2vi6c_:

• d2vi6c_ first appeared in SCOPe 2.01
  
• d2vi6c_ appears in SCOPe 2.07