![]() | Class a: All alpha proteins [46456] (284 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.1: Homeodomain-like [46689] (20 families) ![]() consists only of helices |
![]() | Family a.4.1.0: automated matches [191447] (1 protein) not a true family |
![]() | Protein automated matches [190674] (11 species) not a true protein |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [188321] (2 PDB entries) |
![]() | Domain d2vi6a_: 2vi6 A: [168625] automated match to d1ftta_ |
PDB Entry: 2vi6 (more details), 2.6 Å
SCOPe Domain Sequences for d2vi6a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vi6a_ a.4.1.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} tvfsqaqlcalkdrfqkqkylslqqmqelssilnlsykqvktwfqnqrmkckrwq
Timeline for d2vi6a_: