Lineage for d2vi6a_ (2vi6 A:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1257871Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1257872Superfamily a.4.1: Homeodomain-like [46689] (20 families) (S)
    consists only of helices
  5. 1258653Family a.4.1.0: automated matches [191447] (1 protein)
    not a true family
  6. 1258654Protein automated matches [190674] (11 species)
    not a true protein
  7. 1258670Species Mouse (Mus musculus) [TaxId:10090] [188321] (2 PDB entries)
  8. 1258672Domain d2vi6a_: 2vi6 A: [168625]
    automated match to d1ftta_

Details for d2vi6a_

PDB Entry: 2vi6 (more details), 2.6 Å

PDB Description: crystal structure of the nanog homeodomain
PDB Compounds: (A:) homeobox protein nanog

SCOPe Domain Sequences for d2vi6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vi6a_ a.4.1.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
tvfsqaqlcalkdrfqkqkylslqqmqelssilnlsykqvktwfqnqrmkckrwq

SCOPe Domain Coordinates for d2vi6a_:

Click to download the PDB-style file with coordinates for d2vi6a_.
(The format of our PDB-style files is described here.)

Timeline for d2vi6a_: