Lineage for d1bcn__ (1bcn -)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 2641Fold a.26: 4-helical cytokines [47265] (1 superfamily)
  4. 2642Superfamily a.26.1: 4-helical cytokines [47266] (3 families) (S)
  5. 2696Family a.26.1.2: Short-chain cytokines [47286] (9 proteins)
  6. 2722Protein Interleukin-4 (IL-4) [47291] (1 species)
  7. 2723Species Human (Homo sapiens) [TaxId:9606] [47292] (12 PDB entries)
  8. 2733Domain d1bcn__: 1bcn - [16862]

Details for d1bcn__

PDB Entry: 1bcn (more details)

PDB Description: three-dimensional solution structure of human interleukin-4 by multi-dimensional heteronuclear magnetic resonance spectroscopy

SCOP Domain Sequences for d1bcn__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bcn__ a.26.1.2 (-) Interleukin-4 (IL-4) {Human (Homo sapiens)}
eaeahkcditlqeiiktlnslteqktlcteltvtdifaaskdtteketfcraatvlrqfy
shhekdtrclgataqqfhrhkqlirflkrldrnlwglaglnscpvkeadqstlenflerl
ktimrekyskcss

SCOP Domain Coordinates for d1bcn__:

Click to download the PDB-style file with coordinates for d1bcn__.
(The format of our PDB-style files is described here.)

Timeline for d1bcn__: