Lineage for d1bcna_ (1bcn A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2705447Fold a.26: 4-helical cytokines [47265] (1 superfamily)
    core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections
  4. 2705448Superfamily a.26.1: 4-helical cytokines [47266] (4 families) (S)
    there are two different topoisomers of this fold with different entanglements of the two crossover connections
  5. 2705548Family a.26.1.2: Short-chain cytokines [47286] (14 proteins)
  6. 2705674Protein Interleukin-4 (IL-4) [47291] (1 species)
  7. 2705675Species Human (Homo sapiens) [TaxId:9606] [47292] (18 PDB entries)
  8. 2705693Domain d1bcna_: 1bcn A: [16862]

Details for d1bcna_

PDB Entry: 1bcn (more details)

PDB Description: three-dimensional solution structure of human interleukin-4 by multi-dimensional heteronuclear magnetic resonance spectroscopy
PDB Compounds: (A:) interleukin-4

SCOPe Domain Sequences for d1bcna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bcna_ a.26.1.2 (A:) Interleukin-4 (IL-4) {Human (Homo sapiens) [TaxId: 9606]}
eaeahkcditlqeiiktlnslteqktlcteltvtdifaaskdtteketfcraatvlrqfy
shhekdtrclgataqqfhrhkqlirflkrldrnlwglaglnscpvkeadqstlenflerl
ktimrekyskcss

SCOPe Domain Coordinates for d1bcna_:

Click to download the PDB-style file with coordinates for d1bcna_.
(The format of our PDB-style files is described here.)

Timeline for d1bcna_: