SCOPe 2.06: Domain d2vhlb2: 2vhl B:58-358

Lineage for d2vhlb2 (2vhl B:58-358)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families)
   the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
   has transition metal ions bound inside the barrel

5. Family c.1.9.10: N-acetylglucosamine-6-phosphate deacetylase, NagA, catalytic domain [82261] (1 protein)
   automatically mapped to Pfam PF01979

6. Protein N-acetylglucosamine-6-phosphate deacetylase, NagA, catalytic domain [82262] (3 species)

7. Species Bacillus subtilis [TaxId:1423] [102086] (1 PDB entry)

8. Domain d2vhlb2: 2vhl B:58-358 [168612]
   Other proteins in same PDB: d2vhla1, d2vhlb1
   complexed with fe, glp, pge

Details for d2vhlb2

PDB Entry: 2vhl, 2.05 Å

PDB Description: the three-dimensional structure of the n-acetylglucosamine-6- phosphate deacetylase from bacillus subtilis

PDB Compounds: (B:) N-acetylglucosamine-6-phosphate deacetylase

SCOPe Domain Sequences for d2vhlb2:

Sequence; same for both SEQRES and ATOM records:

>d2vhlb2 c.1.9.10 (B:58-358) N-acetylglucosamine-6-phosphate deacetylase, NagA, catalytic domain {Bacillus subtilis [TaxId: 1423]}
gmidihihggygadtmdasfstldimssrlpeegttsflattitqehgnisqalvnarew
kaaeessllgaellgihlegpfvspkragaqpkewirpsdvelfkkwqqeagglikivtl
apeedqhfelirhlkdesiiasmghtdadsallsdaakagashmthlynamspfhhrepg
vigtalahdgfvteliadgihshplaaklaflakgssklilitdsmrakglkdgvyefgg
qsvtvrgrtallsdgtlagsilkmnegarhmreftncswtdianitsenaakqlgifdrk
g

Timeline for d2vhlb2:

• d2vhlb2 first appeared in SCOPe 2.01
  
• d2vhlb2 appears in SCOPe 2.05
  
• d2vhlb2 appears in SCOPe 2.07
  
• d2vhlb2 appears in the current release, SCOPe 2.08