Lineage for d2vhlb1 (2vhl B:2-57,B:359-394)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2428473Fold b.92: Composite domain of metallo-dependent hydrolases [51337] (1 superfamily)
    pseudobarrel; mixed sheet of 7 strand folded upon itself and "buckled" by two beta-turns
  4. 2428474Superfamily b.92.1: Composite domain of metallo-dependent hydrolases [51338] (12 families) (S)
    this domain is interrupted by the catalytic beta/alpha barrel domain
  5. 2428614Family b.92.1.5: N-acetylglucosamine-6-phosphate deacetylase, NagA [82227] (1 protein)
  6. 2428615Protein N-acetylglucosamine-6-phosphate deacetylase, NagA [82228] (3 species)
  7. 2428616Species Bacillus subtilis [TaxId:1423] [102019] (1 PDB entry)
  8. 2428618Domain d2vhlb1: 2vhl B:2-57,B:359-394 [168611]
    Other proteins in same PDB: d2vhla2, d2vhlb2
    complexed with fe, glp, pge

Details for d2vhlb1

PDB Entry: 2vhl (more details), 2.05 Å

PDB Description: the three-dimensional structure of the n-acetylglucosamine-6- phosphate deacetylase from bacillus subtilis
PDB Compounds: (B:) N-acetylglucosamine-6-phosphate deacetylase

SCOPe Domain Sequences for d2vhlb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vhlb1 b.92.1.5 (B:2-57,B:359-394) N-acetylglucosamine-6-phosphate deacetylase, NagA {Bacillus subtilis [TaxId: 1423]}
aesllikdiaivtenevikngyvgindgkistvsterpkepyskeiqapadsvllpXsvt
vgkdadlvivssdcevilticrgniafiskead

SCOPe Domain Coordinates for d2vhlb1:

Click to download the PDB-style file with coordinates for d2vhlb1.
(The format of our PDB-style files is described here.)

Timeline for d2vhlb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2vhlb2