![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.92: Composite domain of metallo-dependent hydrolases [51337] (1 superfamily) pseudobarrel; mixed sheet of 7 strand folded upon itself and "buckled" by two beta-turns |
![]() | Superfamily b.92.1: Composite domain of metallo-dependent hydrolases [51338] (12 families) ![]() this domain is interrupted by the catalytic beta/alpha barrel domain |
![]() | Family b.92.1.5: N-acetylglucosamine-6-phosphate deacetylase, NagA [82227] (1 protein) |
![]() | Protein N-acetylglucosamine-6-phosphate deacetylase, NagA [82228] (3 species) |
![]() | Species Bacillus subtilis [TaxId:1423] [102019] (1 PDB entry) |
![]() | Domain d2vhlb1: 2vhl B:2-57,B:359-394 [168611] Other proteins in same PDB: d2vhla2, d2vhlb2 complexed with fe, glp, pge |
PDB Entry: 2vhl (more details), 2.05 Å
SCOPe Domain Sequences for d2vhlb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vhlb1 b.92.1.5 (B:2-57,B:359-394) N-acetylglucosamine-6-phosphate deacetylase, NagA {Bacillus subtilis [TaxId: 1423]} aesllikdiaivtenevikngyvgindgkistvsterpkepyskeiqapadsvllpXsvt vgkdadlvivssdcevilticrgniafiskead
Timeline for d2vhlb1: