SCOPe 2.08: Domain d1bbna_: 1bbn A:

Lineage for d1bbna_ (1bbn A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.26: 4-helical cytokines [47265] (1 superfamily)
   core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections

4. Superfamily a.26.1: 4-helical cytokines [47266] (4 families)
   there are two different topoisomers of this fold with different entanglements of the two crossover connections

5. Family a.26.1.2: Short-chain cytokines [47286] (14 proteins)

6. Protein Interleukin-4 (IL-4) [47291] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47292] (18 PDB entries)

8. Domain d1bbna_: 1bbn A: [16861]

Details for d1bbna_

PDB Entry: 1bbn

PDB Description: three-dimensional solution structure of human interleukin-4 by multi-dimensional heteronuclear magnetic resonance spectroscopy

PDB Compounds: (A:) interleukin-4

SCOPe Domain Sequences for d1bbna_:

Sequence; same for both SEQRES and ATOM records:

>d1bbna_ a.26.1.2 (A:) Interleukin-4 (IL-4) {Human (Homo sapiens) [TaxId: 9606]}
eaeahkcditlqeiiktlnslteqktlcteltvtdifaaskdtteketfcraatvlrqfy
shhekdtrclgataqqfhrhkqlirflkrldrnlwglaglnscpvkeadqstlenflerl
ktimrekyskcss

Timeline for d1bbna_:

• d1bbna_ first appeared (with stable ids) in SCOP 1.55, called d1bbn__
  
• d1bbna_ appears in SCOPe 2.07