Lineage for d2vhka_ (2vhk A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2372691Fold b.25: Osmotin, thaumatin-like protein [49869] (1 superfamily)
    sandwich; 11 strands in 2 sheets
  4. 2372692Superfamily b.25.1: Osmotin, thaumatin-like protein [49870] (2 families) (S)
    has two smaller insertion domains
  5. 2372693Family b.25.1.1: Osmotin, thaumatin-like protein [49871] (5 proteins)
    automatically mapped to Pfam PF00314
  6. 2372798Protein automated matches [190195] (6 species)
    not a true protein
  7. 2372811Species Ketemfe (Thaumatococcus daniellii) [TaxId:4621] [186982] (31 PDB entries)
  8. 2372812Domain d2vhka_: 2vhk A: [168608]
    automated match to d1kwna_
    complexed with gol, tla

Details for d2vhka_

PDB Entry: 2vhk (more details), 0.94 Å

PDB Description: atomic resolution (0.94 a) structure of purified thaumatin i grown in sodium l-tartrate at 22c
PDB Compounds: (A:) thaumatin-I

SCOPe Domain Sequences for d2vhka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vhka_ b.25.1.1 (A:) automated matches {Ketemfe (Thaumatococcus daniellii) [TaxId: 4621]}
atfeivnrcsytvwaaaskgdaaldaggrqlnsgeswtinvepgtnggkiwartdcyfdd
sgsgicktgdcggllrckrfgrppttlaefslnqygkdyidisnikgfnvpmnfspttrg
crgvrcaadivgqcpaklkapgggcndactvfqtseyccttgkcgpteysrffkrlcpda
fsyvldkpttvtcpgssnyrvtfcpt

SCOPe Domain Coordinates for d2vhka_:

Click to download the PDB-style file with coordinates for d2vhka_.
(The format of our PDB-style files is described here.)

Timeline for d2vhka_: