Lineage for d2vhjb_ (2vhj B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2112131Family c.37.1.11: RecA protein-like (ATPase-domain) [52670] (21 protein domains)
    core: mixed beta-sheet of 8 strands, order 32451678; strand 7 is antiparallel to the rest
  6. 2112689Protein automated matches [190393] (10 species)
    not a true protein
  7. 2112763Species Pseudomonas phage [TaxId:161736] [188308] (6 PDB entries)
  8. 2112765Domain d2vhjb_: 2vhj B: [168606]
    automated match to d1w4aa_
    protein/RNA complex; complexed with adp; mutant

Details for d2vhjb_

PDB Entry: 2vhj (more details), 1.8 Å

PDB Description: p4 protein from bacteriophage phi12 s252a mutant in complex with adp
PDB Compounds: (B:) ntpase p4

SCOPe Domain Sequences for d2vhjb_:

Sequence, based on SEQRES records: (download)

>d2vhjb_ c.37.1.11 (B:) automated matches {Pseudomonas phage [TaxId: 161736]}
mihlydaksfaklraaqyaafhtdapgswfdhtsgvlesvedgtpvlaigvesgdaivfd
knaqrivaykeksvkaedgsvsvvqvengfmkqghrgwlvdltgelvgcspvvaefgghr
yasgmvivtgkgnsgktplvhalgealggkdkyatvrfgeplsgyntdfnvfvddiaram
lqhrvividslknvigaaggnttsggisrgafdllsdigamaasrgcvviaslnptsndd
kivelvkeasranstslvistdvdgewqvltrtgeglqrlthtlqtsygehsvltihtsk

Sequence, based on observed residues (ATOM records): (download)

>d2vhjb_ c.37.1.11 (B:) automated matches {Pseudomonas phage [TaxId: 161736]}
mihlydaksfaklraaqyaafhtdapgswfdhtsgvlesvedgtpvlaigvesgdaivfd
knaqrivaykeksvkaedgsvsvvqvengfmkqghrgwlvdltgelvgcspvvaefgghr
yasgmvivtgkgnsgktplvhalgealggkdkyatvrfgeplsgyntdfnvfvddiaram
lqhrvividslknviisrgafdllsdigamaasrgcvviaslnptsnddkivelvkeasr
anstslvistdvdgewqvltrtgeglqrlthtlqtsygehsvltihtsk

SCOPe Domain Coordinates for d2vhjb_:

Click to download the PDB-style file with coordinates for d2vhjb_.
(The format of our PDB-style files is described here.)

Timeline for d2vhjb_: